Test it yourself. If it fails, you get a full refund.
Independent test fails? Full refund.
Independent test fails? Full refund.
10 vials per kit, from 1 kit per product and strength. We reply to every quote request within 24 hours. How quotes work →
10 vials per kit · from 1 kit · reply within 24 hours Quotes →
10 vials per kit · from 1 kit Quotes →
Long-acting lipidated amylin analogue of 37 residues
Research topic: Body & metabolism · group: GLP-1 class and amylin analogues
Cagrilintide is a 37-residue analogue of human amylin with a disulfide bridge between cysteines 2 and 7, an amidated C-terminus and a C20 fatty diacid joined to lysine 1 through a γ-glutamyl linker. It is an amylin analogue rather than an incretin, but research often studies it together with GLP-1 analogues, so it sits in the GLP-1 group of our body-composition and metabolic page. It is not part of any approved medicine; we supply it alone, as research material in vials. The literature in our product data covers its design, cryo-EM structures with the receptors it binds, and human studies of the peptide alone and combined with semaglutide.
The COA of every lot of Cagrilintide reports:
Ask for the COA of the batch you are quoted; the batch number on it is the batch we ship.
Each picture is the first page at low resolution, with numbers, dates and signatures covered, so the small print cannot be read. The full, clear copy comes from sales — ask for it by product and strength.
Batch COACagrilintide 2 mg
HPLC purity · MS identity
Lot release certificate
Full, clear copy from sales
Batch COACagrilintide 5 mg
HPLC purity · MS identity
Lot release certificate
Full, clear copy from sales
Batch COACagrilintide 10 mg
HPLC purity · MS identity
Lot release certificate
Full, clear copy from sales
All batch COAs and test reports we show: Batch COA page.
Independent test fails? Full refund. How the refund works
| Field | Value | Source |
|---|---|---|
| Chemical name | Cagrilintide | Our product table |
| Other names | Cagri · AM833 | Our product table |
| Sequence | KCNTATCATQRLAEFLRHSSNNFGPILPPTNVGSNTP | Our product table |
| Molecular formula | C194H312N54O59S2 | Our product table |
| Molecular weight | 4409 g/mol | Our product table |
| CAS number | 1415456-99-3 | Our product table |
| Strengths (per vial) | 2 mg, 5 mg, 10 mg | Our product table |
| Kit and minimum order | 10 vials per kit · from 1 kit per strength | Our product table |
| Form | Lyophilized powder | Our product table |
| Catalogue codes | 2 mg: CAGRI2 · 5 mg: CAGRI5 · 10 mg: CAGRI10 | Our product table |
| Purity specification | ≥ 99.0% (HPLC)Specification; the measured value is on the COA of the lot. | Our product table |
| Appearance | White to off-white lyophilized powder | Our product table |
| Storage | Store at 2–8 °C, protected from light and moisture | Our product table |
| Batch COA | HPLC purity · MS identity · endotoxin · fill — every lot | Our batch COA |
Product-table values checked 2026-10-09. The measured values of a lot are on its COA.
| First author / trial | Year | Journal | What was studied | Record |
|---|---|---|---|---|
| Kruse T | 2021 | J Med Chem | Development of cagrilintide as a long-acting amylin analogue | PubMed 34288673 |
| Cao Y | 2025 | Nat Commun | Cryo-EM structures of cagrilintide bound to amylin and calcitonin receptors | DOI |
| Lau DCW | 2021 | Lancet | Phase 2 trial of cagrilintide alone in people with overweight or obesity | PubMed 34798060 |
| Gabe MBN | 2024 | Diabetes Obes Metab | Thorough QT study in healthy participants | PubMed 39279639 |
| Frias JP | 2023 | Lancet | Cagrilintide with semaglutide in type 2 diabetes(combination) | PubMed 37364590 |
Studies recorded in our product data (checked 2026-10-09). They show what has been researched with this molecule — the materials and models of each study — and are not a statement about the vials we supply.
What to put in your quote request
With these facts the first reply can carry the unit price per kit, shipping and lead time.
No. It is an analogue of amylin, a different pancreatic peptide, and acts on amylin and calcitonin receptors. It is listed with the GLP-1 class because studies often pair the two.
No. This page is for cagrilintide alone. Studies that combined it with semaglutide are marked as combinations in the literature table.
One kit is 10 vials of the same product at the same strength. Each vial holds the stated amount, for example 10 mg of lyophilized peptide; the few solutions are stated per vial in mg or ml. 1 kit per product and strength. One order can combine several products and strengths, each from 1 kit.
HPLC purity, MS identity, endotoxin and fill, on the COA of every lot of a stocked peptide. The COA carries the lot number, so you can match it to the vials you receive. Yes. Ask for the COA of the batch you are quoted; the batch number on that COA is the batch we ship.
In writing, per request. Prices are tiered by the number of kits of each peptide and strength; the quotation gives the unit price per kit, the shipping cost and the lead time. We reply within 24 hours.
Because listings describe different forms: a free peptide or a salt (acetate, TFA), a copper complex or its free peptide, one peptide or a two-peptide material — and some registries keep older numbers. Each product page says which form its values refer to; the COA of the lot is the reference.
Related peptides
