Test it yourself. If it fails, you get a full refund.
Independent test fails? Full refund.
Independent test fails? Full refund.
10 vials per kit, from 1 kit per product and strength. We reply to every quote request within 24 hours. How quotes work →
10 vials per kit · from 1 kit · reply within 24 hours Quotes →
10 vials per kit · from 1 kit Quotes →
Acylated GLP-1 analogue of 31 residues with a C16 palmitoyl side chain
Research topic: Body & metabolism · group: GLP-1 class and amylin analogues
Liraglutide is GLP-1(7-37) with a single change in its backbone, arginine in place of lysine at position 34, and a palmitoyl (C16) chain attached to lysine 26 through a γ-glutamyl spacer. The substitution leaves lysine 26 as the only lysine, and so the only site for the acyl chain. The same molecule is the active ingredient of approved medicines; the vials we supply hold it as research material, which is not a medicine. On our body-composition and metabolic page it sits in the GLP-1 and amylin group, beside semaglutide, the other acylated analogue of 31 residues. The studies in our product data are two randomised trials in type 2 diabetes: a comparison with glimepiride and a cardiovascular-outcome trial.
Same molecule, not a medicine
Liraglutide is the active ingredient of approved medicines. What we supply is the same molecule, but not a medicine: lyophilized research material in vials, not a finished drug product.
Besides the vials, Liraglutide is bottled as a nasal spray, held in stock in the United States and shipped from there.
The COA of every lot of Liraglutide reports:
Ask for the COA of the batch you are quoted; the batch number on it is the batch we ship.
Independent test fails? Full refund. How the refund works
| Field | Value | Source |
|---|---|---|
| Chemical name | Liraglutide | Our product table |
| Other names | NN2211 · NNC 90-1170 | Our product table |
| Sequence | HAEGTFTSDVSSYLEGQAAKEFIAWLVRGRG | Our product table |
| Molecular formula | C172H265N43O51 | Our product table |
| Molecular weight | 3751.3 g/molCalculated from the formula shown; our product table gives no value. | Calculated from the formula (standard atomic weights) |
| CAS number | 204656-20-2 | Our product table |
| Strengths (per vial) | 5 mg, 10 mg, 20 mg, 30 mg | Our product table |
| Kit and minimum order | 10 vials per kit · from 1 kit per strength | Our product table |
| Form | Lyophilized powder | Our product table |
| Catalogue codes | 5 mg: LIRA5 · 10 mg: LIRA10 · 20 mg: LIRA20 · 30 mg: LIRA30 | Our product table |
| Purity specification | ≥ 99.0% (HPLC)Specification; the measured value is on the COA of the lot. | Our product table |
| Appearance | White to off-white lyophilized powder | Our product table |
| Storage | Store at 2–8 °C, protected from light and moisture | Our product table |
| Batch COA | HPLC purity · MS identity · endotoxin · fill — every lot | Our batch COA |
Product-table values checked 2026-10-09. The measured values of a lot are on its COA.
| First author / trial | Year | Journal | What was studied | Record |
|---|---|---|---|---|
| Garber A | 2009 | Lancet | Liraglutide against glimepiride over 52 weeks in type 2 diabetes (LEAD-3 Mono) | PubMed 18819705 |
| Marso SP | 2016 | N Engl J Med | Cardiovascular outcomes against placebo in people with type 2 diabetes (LEADER) | PubMed 27295427 |
Studies recorded in our product data (checked 2026-10-09). They show what has been researched with this molecule — the materials and models of each study — and are not a statement about the vials we supply.
What to put in your quote request
With these facts the first reply can carry the unit price per kit, shipping and lead time.
Both are 31-residue GLP-1 analogues with arginine at position 34. Semaglutide also has 2-aminoisobutyric acid at position 8 and a C18 diacid on a longer linker; liraglutide keeps alanine 8 and carries a C16 fatty acid. Their formulas, masses and CAS numbers differ.
Chemically yes: sequence, side chain, formula and CAS are those of liraglutide. Approved liraglutide products are finished solutions with their own labelling; we supply lyophilized powder for research, which is not a medicine.
One kit is 10 vials of the same product at the same strength. Each vial holds the stated amount, for example 10 mg of lyophilized peptide; the few solutions are stated per vial in mg or ml. 1 kit per product and strength. One order can combine several products and strengths, each from 1 kit.
HPLC purity, MS identity, endotoxin and fill, on the COA of every lot of a stocked peptide. The COA carries the lot number, so you can match it to the vials you receive. Yes. Ask for the COA of the batch you are quoted; the batch number on that COA is the batch we ship.
In writing, per request. Prices are tiered by the number of kits of each peptide and strength; the quotation gives the unit price per kit, the shipping cost and the lead time. We reply within 24 hours.
Because listings describe different forms: a free peptide or a salt (acetate, TFA), a copper complex or its free peptide, one peptide or a two-peptide material — and some registries keep older numbers. Each product page says which form its values refer to; the COA of the lot is the reference.
Related peptides
Lipidated GLP-1 receptor agonist peptide of 31 residues
Nasal spray available
GLP-1 analogue fused through a peptide linker to a modified human IgG4 Fc domain
Dual GIP and GLP-1 receptor agonist peptide of 39 residues
Nasal spray available
