Test it yourself. If it fails, you get a full refund.
Independent test fails? Full refund.
Independent test fails? Full refund.
10 vials per kit, from 1 kit per product and strength. We reply to every quote request within 24 hours. How quotes work →
10 vials per kit · from 1 kit · reply within 24 hours Quotes →
10 vials per kit · from 1 kit Quotes →
Human cathelicidin peptide of 37 residues, released from the precursor hCAP18
Research topic: Skin & ageing · group: Other skin-research compounds
LL-37 is the human cathelicidin peptide, named after its first two residues, both leucine, and its length of 37. Proteinase 3 releases it by cutting the C-terminal stretch off the precursor protein hCAP18, outside the cell. The chain is linear and strongly cationic, has no cysteine and ends in a free acid; its international non-proprietary name is ropocamptide. On pepoderma it is grouped with the other skin-research compounds of the skin and ageing topic, because the human studies in our product data looked at chronic skin ulcers. Those records cover the cleavage that frees the peptide from its precursor and three randomised trials of investigational LL-37 formulations: two in venous leg ulcers, one in diabetic foot ulcers.
Besides the vials, LL-37 is bottled as a nasal spray, held in stock in the United States and shipped from there.
The COA of every lot of LL-37 reports:
Ask for the COA of the batch you are quoted; the batch number on it is the batch we ship.
Independent test fails? Full refund. How the refund works
| Field | Value | Source |
|---|---|---|
| Chemical name | LL-37 | Our product table |
| Other names | Cathelicidin LL-37 · Ropocamptide · hCAP18 (134-170) · CAP-18 (104-140) | Our product table |
| Sequence | [LL-37, 37 aa] | Our product table |
| Molecular formula | C205H340N60O53 | Our product table |
| Molecular weight | 4493.3 g/molCalculated from the formula shown; our product table gives no value. | Calculated from the formula (standard atomic weights) |
| CAS number | 154947-66-7 | Our product table |
| Strengths (per vial) | 5 mg | Our product table |
| Kit and minimum order | 10 vials per kit · from 1 kit per strength | Our product table |
| Form | Lyophilized powder | Our product table |
| Catalogue codes | 5 mg: LL5 | Our product table |
| Purity specification | ≥ 99.0% (HPLC)Specification; the measured value is on the COA of the lot. | Our product table |
| Appearance | White to off-white lyophilized powder | Our product table |
| Storage | Store at 2–8 °C, protected from light and moisture | Our product table |
| Batch COA | HPLC purity · MS identity · endotoxin · fill — every lot | Our batch COA |
Product-table values checked 2026-10-09. The measured values of a lot are on its COA.
| First author / trial | Year | Journal | What was studied | Record |
|---|---|---|---|---|
| Sorensen OE | 2001 | Blood | How proteinase 3 cleaves the precursor hCAP-18 outside the cell to release LL-37 | PubMed 11389039 |
| Gronberg A | 2014 | — | Placebo-controlled trial of an investigational LL-37 formulation in chronic venous leg ulcers | PubMed 25041740 |
| Mahlapuu M | 2021 | — | Multicentre placebo-controlled trial of LL-37 in 148 patients with venous leg ulcers | PubMed 34687253 |
| Miranda E | 2023 | — | Double-blind controlled trial of an LL-37 cream in diabetic foot ulcers | PubMed 37480520 |
Studies recorded in our product data (checked 2026-10-09). They show what has been researched with this molecule — the materials and models of each study — and are not a statement about the vials we supply.
What to put in your quote request
With these facts the first reply can carry the unit price per kit, shipping and lead time.
No. hCAP18 is the 170-residue precursor protein, and LL-37 its released C-terminal fragment: residues 134–170, or 104–140 when counted from the mature protein. FALL-39 is a sibling fragment two residues longer. Their masses differ widely, so the MS identity on the COA tells them apart.
A free acid. The formula and molecular weight in the fact table refer to that form. The C-terminal amide would be about one dalton lighter and falls outside the mass window of our specification.
One kit is 10 vials of the same product at the same strength. Each vial holds the stated amount, for example 10 mg of lyophilized peptide; the few solutions are stated per vial in mg or ml. 1 kit per product and strength. One order can combine several products and strengths, each from 1 kit.
HPLC purity, MS identity, endotoxin and fill, on the COA of every lot of a stocked peptide. The COA carries the lot number, so you can match it to the vials you receive. Yes. Ask for the COA of the batch you are quoted; the batch number on that COA is the batch we ship.
In writing, per request. Prices are tiered by the number of kits of each peptide and strength; the quotation gives the unit price per kit, the shipping cost and the lead time. We reply within 24 hours.
Because listings describe different forms: a free peptide or a salt (acetate, TFA), a copper complex or its free peptide, one peptide or a two-peptide material — and some registries keep older numbers. Each product page says which form its values refer to; the COA of the lot is the reference.
Related peptides
3-mer
Lys-Pro-Val, the C-terminal tripeptide of α-MSH, as a free acid
Nasal spray availableCapsules available
N-acetylated thymic peptide of 28 residues with a free C-terminal acid
Nasal spray available
3-mer
Copper(II) complex of the tripeptide Gly-His-Lys
Nasal spray availableCapsules available
